PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009626205.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WRKY
Protein Properties Length: 590aa    MW: 64082.2 Da    PI: 7.1782
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009626205.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY99.12.7e-31247304260
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                     dDgynWrKYGqK vkgsefprsYY+Ct+++C+vkk  ers  +++++ei+Y+g+H+h+k
  XP_009626205.1 247 DDGYNWRKYGQKLVKGSEFPRSYYKCTYPNCEVKKIFERSP-EGQITEIVYKGSHDHPK 304
                     8****************************************.***************85 PP

2WRKY106.21.7e-33411469159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK+v+g+++prsYY+Ct agCpv+k+ver+++dpk+v++tYeg+Hnh+
  XP_009626205.1 411 LDDGYRWRKYGQKVVRGNPNPRSYYKCTNAGCPVRKHVERASHDPKAVITTYEGKHNHD 469
                     59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.4E-26237305IPR003657WRKY domain
PROSITE profilePS5081122.435241305IPR003657WRKY domain
SuperFamilySSF1182902.35E-24243305IPR003657WRKY domain
SMARTSM007743.4E-33246304IPR003657WRKY domain
PfamPF031069.1E-24247303IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.3E-37396471IPR003657WRKY domain
SuperFamilySSF1182902.09E-29403471IPR003657WRKY domain
PROSITE profilePS5081138.825406471IPR003657WRKY domain
SMARTSM007743.1E-39411470IPR003657WRKY domain
PfamPF031063.6E-26412469IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 590 aa     Download sequence    Send to blast
MEDSHSQSHS HSQQQHSSSE QLRDGIPAVP DGGFSSGAAG SSGGAKYKLM TPAKLPISRS  60
TCITIPPGLS PSSFLESPVL LSNIKAEPSP TTGSFSKLQA VQGSGGNAAF LLTRGYSSGN  120
TYSERKSSCF EFKFAGGSSS TSGSLAAEHV ISTGLNQQPD EPLKEVQDQS HPQLVATSSL  180
AKHEMASSKE LSLSAPINVD DSSKEESLSA PMNVDAMNMR SQSNTSMQVS LVDHKDVSSV  240
TAERSSDDGY NWRKYGQKLV KGSEFPRSYY KCTYPNCEVK KIFERSPEGQ ITEIVYKGSH  300
DHPKPQLSRR FTPGALMSIQ EDKFFVEDKF NTNAQTSKIE PISTPVSPQQ VDADGPEGAV  360
SQMQGTNDDM DEDDPFVKRR KMDGAVDITP VIKPIREPRV VVQTVSEVDI LDDGYRWRKY  420
GQKVVRGNPN PRSYYKCTNA GCPVRKHVER ASHDPKAVIT TYEGKHNHDV PAARSNNHEM  480
AGSTPVTGGS RIRAEETYSI NLDLGVGFGY GVENGNNRQL HTVHNQVQVS RSGMMVVQPA  540
AIAARYGIVN GGMSRFGPID NHVQGHGFET LPLQPSTQFP QNYGKILLGP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A8e-38247472878Probable WRKY transcription factor 4
2lex_A8e-38247472878Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB7111290.0AB711129.1 Solanum tuberosum StWRKY17 mRNA for transcription factor, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009626205.10.0PREDICTED: probable WRKY transcription factor 20 isoform X1
SwissprotQ93WV01e-152WRK20_ARATH; Probable WRKY transcription factor 20
TrEMBLK4CHK50.0K4CHK5_SOLLC; Uncharacterized protein
STRINGSolyc07g065260.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA40252344
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.21e-152WRKY family protein